Protein Info for PS417_12970 in Pseudomonas simiae WCS417

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 3 to 190 (188 residues), 117.1 bits, see alignment E=8.7e-38 PF03358: FMN_red" amino acids 16 to 143 (128 residues), 40 bits, see alignment E=2.9e-14

Best Hits

Swiss-Prot: 48% identical to AZOR4_PSEF5: FMN-dependent NADH-azoreductase 4 (azoR4) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 53% identity to pfv:Psefu_4001)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UF28 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PS417_12970 FMN-dependent NADH-azoreductase (Pseudomonas simiae WCS417)
MTRALLLSFSPHGKAAQTFKLARALLRDLVPDAEVTERDYGSQALPPLTREYANALTTPG
GLGSSATALSEQLIVELEACDLLILCTPVHNFTVPAALKTWIDHVVRIQRSFTVNEQFAK
VGLLQDRRTFVLVSSGNARKGHEPDFLTPYMSTILSTVGIHAVDFVYLPAMVRGEEAVNR
ALEQAHRQLAVAISSGL