Protein Info for PS417_12950 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 260 (167 residues), 100.2 bits, see alignment E=6.1e-33

Best Hits

Swiss-Prot: 41% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 97% identity to pfs:PFLU2790)

MetaCyc: 42% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1T1C8 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PS417_12950 ABC transporter permease (Pseudomonas simiae WCS417)
MTSKTQALPLVEPVAINRSAWPRRLKGLVLPVLILLVLEVVVRVGWLPSYQMPAPSEIAV
TLTDLAEGSLWKHISASLGRVLLGFAIGASLALVFAAWVGLSREAEAYLEPTFAGLRSIP
SLAWVPLLLLWLGIDETSKIVLIAIGAFFPVYLNGVAAIRDIDRKLVEVGQMYGFSRWRL
VRRILLPAALPGLFTGLRSGLSLAWMFLVAAELIAATKGLGYLLSDGRETSRPDIVLAAI
IVLASLGKVSDGLLATLEKRCLAWRDTFQGAGQ