Protein Info for GFF254 in Xanthobacter sp. DMC5

Annotation: Thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR03284: thymidylate synthase" amino acids 3 to 84 (82 residues), 141.4 bits, see alignment E=1.8e-45 amino acids 85 to 264 (180 residues), 330.4 bits, see alignment E=4.8e-103 PF00303: Thymidylat_synt" amino acids 3 to 264 (262 residues), 430.6 bits, see alignment E=9.5e-134

Best Hits

Swiss-Prot: 79% identical to TYSY_METC4: Thymidylate synthase (thyA) from Methylobacterium extorquens (strain CM4 / NCIMB 13688)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 93% identity to xau:Xaut_3514)

MetaCyc: 67% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF254 Thymidylate synthase (Xanthobacter sp. DMC5)
MEAYHQLLRRILDEGVRKDDRTGTGTLSVFGHQMRFDLARGFPLVTTKKLHLKSIVHELL
WFLAGDTNIRYLKENGVSIWDEWADAKGDLGPVYGHQWRSWPTPEGGVIDQIAQVVSDIR
RNPDSRRLIVTAWNPADVAKMALPPCHCLFQFYVLEGKLSCQLYQRSADVFLGVPFNIAS
YALLTHMVAQVTGLGVGDFVHTLGDAHLYVNHLDQAREQLSRTPRALPSLRLNPTVTDIF
AFRYEDIEIVGYDPHPAIKAPVAV