Protein Info for GFF2537 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 7 to 306 (300 residues), 114.6 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 62% identity to acr:Acry_2889)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF2537 hypothetical protein (Sphingobium sp. HT1-2)
MLSVLLIVLPIFALIGAGWIARRSGVLGPHATGELNRFVVWLALPALLFDIVAKARWSDI
WQPGFIAVFGIGAGLSFAATLLLRRRGGRHLADATVDGLNAGYANTGFIGFPLAATILGP
ASLAPTLVATIMTVCLLFAIALILIEIGVQSERRPGHMMAKVARSLATNPLLVAPLVGGL
FLAFAIPLSAPLDKFLSLLGGAASPCALVALGLFIAEKRVGAPPPAGAVGFLVGMKLLAQ
PLLTGALALIFRLPPVLAATAVLMAALPTGTGPFMIAEFYGREAGITARVVLVSTIASLV
TITLYLSLR