Protein Info for GFF2532 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 20 to 49 (30 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 410 to 427 (18 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details amino acids 464 to 487 (24 residues), see Phobius details PF01970: TctA" amino acids 20 to 439 (420 residues), 489.2 bits, see alignment E=4.5e-151

Best Hits

KEGG orthology group: None (inferred from 97% identity to xau:Xaut_0484)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>GFF2532 hypothetical protein (Xanthobacter sp. DMC5)
VEALTSLIGGFGVLADPMNIIYMFVGIALGVLIGVLPGLGGANGVAILLPLTFSMTPVSA
IIMLSSIYWGALFGGAITSILFNIPGEPWSVATTFDGHPMAQKGKAGEALTGAFTGSFIG
AFFAVLLITFLAPVIAKFALQFGPAEFFAVYLLTFCAFVGMGREPAAKVISAMMLGFALA
AVGIDTVTGQLRMTFGSVELLRGFDFLVAVIGLFGVGEILLTMEEGLAFKGKSAAINAKV
VWETWKKLPKYWVGCLRSAIVGCWMGVTPGGATPASFMSYGLAKKFSKNGNNFGKGELEG
VVMPEVAAHAAGTSALLPMLTLGIPGSPTAAVLLGGLLIWGLQPGPLLFVEQKDFVWGLI
ASIYLGNIAGLIVVLTTVPIFAAILRIPFSVIAPVILVICAVGAYTVHNAGLDIAVMLVF
GVIGYLFKKLQYPLAPLVLALVLGDMAESSFRQAMLVSQGHLSIFWSNPLVGSIVTLALV
MLVWPLVSKVMARLNGHKEPAAAE