Protein Info for PS417_12885 in Pseudomonas simiae WCS417

Annotation: phosphatidylcholine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 18 to 162 (145 residues), 29.3 bits, see alignment E=5.3e-11

Best Hits

Swiss-Prot: 66% identical to PCS_PSEAE: Phosphatidylcholine synthase (pcs) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01004, phosphatidylcholine synthase [EC: 2.7.8.24] (inferred from 98% identity to pfs:PFLU2780)

Predicted SEED Role

"Phosphatidylcholine synthase (EC 2.7.8.24)" in subsystem ZZ gjo need homes (EC 2.7.8.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBL2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PS417_12885 phosphatidylcholine synthase (Pseudomonas simiae WCS417)
MISTLHVARLKAWGAHGFTATGVVLAFLATLALLENSPKACLLWLGLALVVDGVDGSLAR
RVNVSTVLPSFDGSVLDLVIDYLTYVFIPALFIYRYIDLPDFTHLFAVSVILVSSLFCFC
NVNMKSKDNYFVGFPAAWNVVALCVYIIQPEAWVTLLTVIGLALLTVTPMKFLHPFRVKR
FMPINIAVTTIWLLCSFLMVVDYPNTNPWTFGLWSLMSAYFLGICIWRTALEWIEKRHG