Protein Info for GFF2516 in Xanthobacter sp. DMC5

Annotation: Dihydroanticapsin 7-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 10 to 158 (149 residues), 41.1 bits, E=2.8e-14
• PF00106: adh_short
  • amino acids 10 to 196 (187 residues), 166.3 bits, E=9.3e-53
• PF13561: adh_short_C2
  • amino acids 17 to 252 (236 residues), 176 bits, E=1.5e-55

Best Hits

KEGG orthology group: None (inferred from 88% identity to xau:Xaut_0432)

MetaCyc: 46% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• ketogenesis (4/5 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.M55

Protein Sequence (258 amino acids)

>GFF2516 Dihydroanticapsin 7-dehydrogenase (Xanthobacter sp. DMC5)
MDLGIAGIRVIVTAGAGGIGLEIARAFLKEGAKVEVCDVDDAALEALGDTAPGATGTWCD
VSDRASVAAFMEGALGRLCGLDVLVNNAGIAGPTGRVDQISPEDWDRTLAVDITGHFNVT
RLAVPALKESENASIIGLSSAAGRFGFPLRSPYAAAKWGVVGFIKSLAMELGEFGIRANA
ILPGSVDGPRIRSVFENKARERNMSMEEVQAMALSATSLKRLIPPQHLANVAVFLSSPMG
STISGQAIAVDGDMQMLV