Protein Info for GFF2515 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13577: SnoaL_4" amino acids 38 to 161 (124 residues), 27.3 bits, see alignment E=8.3e-10 PF08332: CaMKII_AD" amino acids 39 to 165 (127 residues), 30 bits, see alignment E=1.3e-10 PF13474: SnoaL_3" amino acids 47 to 167 (121 residues), 24.3 bits, see alignment E=8.6e-09 PF14534: DUF4440" amino acids 67 to 158 (92 residues), 35 bits, see alignment E=4.3e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to sty:STY1533)

Predicted SEED Role

"putative outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF2515 putative outer membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQKTSLLFSAAAITLTLMASSASAATPTAAQNEATSTVKQEITEGINRYLYSIDKADPTL
GKQLFYVSPETSFIHPRGHERGWSQIAENFYGTTMGKTFSKRTLKLDAPPAIHVYGNAAV
AEFDWHFTAVRRDNGQTQHTTGRESQVWAKIPNTGWRIVHVHYSGPAKTGVGEGY