Protein Info for GFF2512 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 228 to 262 (35 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details PF04632: FUSC" amino acids 14 to 157 (144 residues), 60.8 bits, see alignment E=1.1e-20 PF13515: FUSC_2" amino acids 20 to 149 (130 residues), 55.4 bits, see alignment E=7.2e-19 amino acids 193 to 317 (125 residues), 36.2 bits, see alignment E=6.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>GFF2512 hypothetical protein (Xanthobacter sp. DMC5)
MAAAGWSARQGLITAASVVLALLMAAALGLEGLWWAAISAWIVSNPDFSALWRKAGMRLA
GTAVGLSAGYLLAVALEGIPLFQALALFIICGVGSYLRFSSRYGYAWFYGTITLMLMLAV
SILETEALFSFAENRFLEIACGVVASAVVHAVGRPRTDPAAPAAAPVPAHPADLDLVHIG
LVAGISAIAMVTLWSWFDLPSLPQAIGSSLAVLDRDFGTMRARGRQRVLGCVLGALAGLA
ALLLQLDTLLVYLTVLAGGIFYFSRLHTGGGPQSYIGTQGGVAFITALVTDGGPPAELMP
VVERLAGIFIGVALMLIASFVLSALLHGRRAHVAATDPAG