Protein Info for GFF2511 in Variovorax sp. SCN45

Annotation: Octaprenyl diphosphate synthase (EC 2.5.1.90)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00348: polyprenyl_synt" amino acids 17 to 261 (245 residues), 280.6 bits, see alignment E=5e-88

Best Hits

Swiss-Prot: 53% identical to ISPB_ECOLI: Octaprenyl diphosphate synthase (ispB) from Escherichia coli (strain K12)

KEGG orthology group: K02523, octaprenyl-diphosphate synthase [EC: 2.5.1.90] (inferred from 95% identity to vpe:Varpa_4831)

MetaCyc: 53% identical to all-trans-octaprenyl-diphosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-8992 [EC: 2.5.1.90]

Predicted SEED Role

"FIG002203: Octaprenyl-diphosphate synthase (EC 2.5.1.-)" (EC 2.5.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.90

Use Curated BLAST to search for 2.5.1.- or 2.5.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF2511 Octaprenyl diphosphate synthase (EC 2.5.1.90) (Variovorax sp. SCN45)
MIEVDRVISRRLDTGVPLVSQVSKYIISAGGKRLRPALLLLMSGALGYTGEQRFNLAAVV
EFIHTATLLHDDVVDESTLRRGRATANESFGNPASVLVGDFLYSRAFQMMLDANNMRVMQ
ILAEATNVIAEGEVLQLMNMHDASLDEAAYLRVIRSKTAKLFEASTRLAAVLAGTTPEVE
EACATYGQALGTAFQVIDDVLDYAGDANETGKNVGDDLREGKTTLPLIFAMQRGTPAQSQ
LVRAAIEAGDTAQLGKVVEIVRETGALDASREAAAAEAQRAIHALNGFPSNLHASGLLQL
AAQLLERRA