Protein Info for GFF2511 in Sphingobium sp. HT1-2

Annotation: FIG001614: Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 205 to 236 (32 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details PF06166: DUF979" amino acids 6 to 311 (306 residues), 392.5 bits, see alignment E=7.1e-122

Best Hits

KEGG orthology group: None (inferred from 66% identity to swi:Swit_2481)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF2511 FIG001614: Membrane protein (Sphingobium sp. HT1-2)
MITLHWVYALMGAVFAGYALLGAADRSNPRRFTTATFWALLALSMWAGDRLGDIGNGILV
LGLVAIAGFKGLGRGSGGVPLEERQARADRHGNGLFAIALVIPVTALAGTFLFKAFPAWI
DPKQTTLISLALGVLIALGIGCSWLRARPIVALQQGRQLMDSVGWVGILPQMLASLGAVF
ALAGVGDVVGGIVRLAIPDGSLLGAVIAYGLGMALFTIVMGNAFAAFPVMTAAIGIPLLI
HQYHGDPAIICAIGMLAGFCGTLLTPMAANFNLLPAALLQLKDEYGVIRRQVGTALPLLC
VNILLIYWLAFR