Protein Info for GFF251 in Sphingobium sp. HT1-2

Annotation: Site-specific tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF02899: Phage_int_SAM_1" amino acids 11 to 93 (83 residues), 49.2 bits, see alignment E=5.2e-17 PF00589: Phage_integrase" amino acids 136 to 287 (152 residues), 109.8 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 46% identical to XERC_BRADU: Tyrosine recombinase XerC (xerC) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 84% identity to sch:Sphch_1706)

Predicted SEED Role

"Integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF251 Site-specific tyrosine recombinase XerC (Sphingobium sp. HT1-2)
MTDSVPPSLPERWRQHLSLDRRRSAHTVRAYVATAERLVAFLAEHQGQAVTAASLARLEQ
ADLRAYLASRRVDGIGNISAARELSAVRGFLKFVGGAEARVPQLKGPRVKRGLPRPISPD
EALALAGDVAEGAREDWIGARDWAVLLLLYGAGLRIGEAMGLMGDIMPLGDTLRVTGKRG
KTRLVPLLPQVRSAIEAYADQCPWSPERDQPLFRGARGGPLSAALIRRSVQGARGRLGLS
DRTTPHALRHSFATHLLGRGADLRSLQELLGHASLTSTQVYTQVDAAHLLDVYRAAHPRA