Protein Info for GFF2509 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: CAMP phosphodiesterases class-II:Metallo-beta-lactamase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF00753: Lactamase_B" amino acids 37 to 131 (95 residues), 29.3 bits, see alignment E=1.3e-10 PF12706: Lactamase_B_2" amino acids 47 to 243 (197 residues), 54.5 bits, see alignment E=1.8e-18 PF02112: PDEase_II" amino acids 66 to 160 (95 residues), 41.3 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 68% identity to rfr:Rfer_3939)

Predicted SEED Role

"CAMP phosphodiesterases class-II:Metallo-beta-lactamase superfamily" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF2509 CAMP phosphodiesterases class-II:Metallo-beta-lactamase superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQPVFPPDGPAIPVMPLPKPPMRVRVLGCSGAIAQGCRTTSFLLDDNVLIDAGTGVGDLT
LDEMARVDHVLLTHSHLDHVAALPLMLDAVAARRMASGAAPLQVHALPGTIAALKVHIFN
NLIWPDFSAIPSVDMPLMRFVSISVGEVLQVGGKAIEVLPAVHTVPAVGFAAASASGHWV
FSGDTGRNPAFWQRVNQLPVALLVIETAFSDREQALAQRSLHLAPGLLAQELAQIDGHQR
YPIYITHTKPAETGLIMEEIQRFDEAPTVGGDARHDIRWLSAGQTFEL