Protein Info for GFF2508 in Variovorax sp. SCN45

Annotation: Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 241 to 271 (31 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF06750: A24_N_bact" amino acids 14 to 150 (137 residues), 115.1 bits, see alignment E=1.3e-37 PF01478: Peptidase_A24" amino acids 162 to 270 (109 residues), 88.5 bits, see alignment E=3.7e-29

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 87% identity to vpe:Varpa_4834)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF2508 Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-) (Variovorax sp. SCN45)
MLVSREIDTVFAGVLGLLIGSFLNVVIYRIPVMMYRDWLAEAVFNLMPSKDTPSLWSLVF
GPKATPPAGLEAAAEKAAPAIEALPPFNLMRPASRCGSCGHQIRWYQNIPVLSYVLLRGR
CASCKTPISPRYPLVELITAGLFALCAYRFGITPTGALWAAFGALLVCQFLIDFDTQFLP
DSLNYPLLWLGLVGAAMGWTGVSLNAAVWGAVFGYLSLWLVYHGFRLITGKEGMGYGDFK
LLAALGAWLGADYLIAIILVSSLVGAVIGLTLRFAGKLAHKDIPIAFGPFLAGAGLVCLV
AGPELVKQWIPFAFPLGALVH