Protein Info for PS417_12780 in Pseudomonas simiae WCS417

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 37 to 465 (429 residues), 558.9 bits, see alignment E=4.3e-172 PF12801: Fer4_5" amino acids 93 to 126 (34 residues), 24.9 bits, see alignment 6.6e-09 amino acids 196 to 234 (39 residues), 7.2 bits, see alignment 0.0022 PF13746: Fer4_18" amino acids 215 to 321 (107 residues), 149 bits, see alignment E=2.4e-47 PF13534: Fer4_17" amino acids 219 to 283 (65 residues), 22.7 bits, see alignment E=4.9e-08 PF11614: FixG_C" amino acids 350 to 466 (117 residues), 95.4 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU2756)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXC6 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PS417_12780 (Fe-S)-binding protein (Pseudomonas simiae WCS417)
MSEHIPTVEIFEPTHPKKVKAKSSDNLIHTRSFTGLFRTLRVSGAGFLFLAFFGTVWLNW
DDRQAVLWDLAESKFHIFGATFWPQDFILLSALLIICAFGLFAITVFAGRVWCGYTCPQS
SFTWLFMWCEKVTEGERNQRIKLQAAPWSLNKLARRSAKHTLWLGISVLTGLTFVGYFTP
IRPLAAELLTWQMGGVSLFWVLFFTGATYINAGWLREAVCMHMCPYARFQSVMFDKDTLT
ISYDVARGEQRGPRKREVKPADVGLGDCIDCQLCVQVCPTGIDIRDGLQMECIGCAACID
ACDSIMDKMGYPRGLVSYTSEHQLQGGKTHLLRPRLIGYSAVLLVMIAALVVALVERPMV
SLDVTKDRGMFRENAQGLIENIYSLKVINKTQQRQDYRLELVDAEGFQLQGKTEISLAPG
EISDVPVSVALLADKPASSSQTLRFKVTDVDEPWIYSAADSRFVAPLNR