Protein Info for GFF2501 in Xanthobacter sp. DMC5

Annotation: ATP synthase subunit c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details PF00137: ATP-synt_C" amino acids 9 to 71 (63 residues), 49.3 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 68% identical to ATPL_RHOS4: ATP synthase subunit c (atpE) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 97% identity to xau:Xaut_1978)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (75 amino acids)

>GFF2501 ATP synthase subunit c (Xanthobacter sp. DMC5)
MDPAAGKFIGAGLACLGMGLAGVGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGL
GIFSLVVALVLLFVA