Protein Info for GFF2500 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: C-terminal domain of CinA paralog, YdeJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF02464: CinA" amino acids 19 to 168 (150 residues), 170.5 bits, see alignment E=1.1e-54 TIGR00199: amidohydrolase, PncC family" amino acids 25 to 167 (143 residues), 165 bits, see alignment E=6.3e-53

Best Hits

Swiss-Prot: 61% identical to YDEJ_ECOLI: Protein YdeJ (ydeJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sew:SeSA_A1617)

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF2500 C-terminal domain of CinA paralog, YdeJ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRLEQHDIVTLDEAESVDSLTKKLGDLLVNQKLRLTTAESCTGGKLASALCAAEDTPSFY
GVGYVTFTDEAKAKILRVQRHSLAEHTAVSEAVVTEMAQGAKDQAEVNISIAISGYGGPE
GGEDGTPAGTVWFAWNINNTTFTSRQHFNGDCQEVLEKCVRFALAELLFLLTKKA