Protein Info for GFF250 in Xanthobacter sp. DMC5

Annotation: Acetone carboxylase gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08882: Acetone_carb_G
  • amino acids 45 to 158 (114 residues), 195.4 bits, E=1.2e-62

Best Hits

Swiss-Prot: 94% identical to ACXC_XANP2: Acetone carboxylase gamma subunit (acxC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K10856, acetone carboxylase, gamma subunit [EC: 6.4.1.6] (inferred from 94% identity to xau:Xaut_3511)

MetaCyc: 94% identical to acetone carboxylase gamma subunit (Xanthobacter autotrophicus Py2)
Acetone carboxylase. [EC: 6.4.1.6]

Predicted SEED Role

"Acetone carboxylase, gamma subunit (EC 6.4.1.6)" (EC 6.4.1.6)

MetaCyc Pathways

• acetone degradation II (to acetoacetate) (1/1 steps found)

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.6

Use Curated BLAST to search for 6.4.1.6

Protein Sequence (168 amino acids)

>GFF250 Acetone carboxylase gamma subunit (Xanthobacter sp. DMC5)
MSYTRAKIVDLVEGKIDPDTLHQMLSTPKDPERFVTYVEILQERVPWDDKIILPLGPKLF
IVQQKVSKKWTVRCECGHDFCDWKDNWKLHARVHVRDTPQKMEEIYPRLMAPTPSWQVIR
EYFCPECGTLHDVEAPTPWYPVIHDFEPDIDAFYTEWLGLPVPERAAA