Protein Info for GFF2494 in Xanthobacter sp. DMC5

Annotation: Ferrous-iron efflux pump FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details PF01545: Cation_efflux" amino acids 13 to 208 (196 residues), 102.3 bits, see alignment E=3.2e-33 TIGR01297: cation diffusion facilitator family transporter" amino acids 20 to 280 (261 residues), 110 bits, see alignment E=6.7e-36 PF16916: ZT_dimer" amino acids 219 to 280 (62 residues), 35 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to xau:Xaut_1971)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF2494 Ferrous-iron efflux pump FieF (Xanthobacter sp. DMC5)
VSGSASQNLSFQAMIFTACLFPFYILAATLTNSAAILTDLLATSFDLTALTACWLVLKLA
HKAHAGKYAYGLGKLENLAELMIALLQTILVVIAGTRAIIRVMHPEGVDGAELGLFVAAL
AVVGNVILNRKATRLARETHSPVLAAQARVHLVSAIASGSVFTVTVILSIFNNIPILYYL
DPMGSFVVIGFMIYNIYAMLSNSVASLLDQAIDEAGQLRILKVLTTHFDDFDELGDIRTR
QFGGKMFVELHLGFESDWTVARARAVVAKLTESVKREFREAGDEVDVSIVLMPGHAASAE
AKAV