Protein Info for PS417_12710 in Pseudomonas simiae WCS417

Updated annotation (from data): ABC transporter for D-Mannitol and D-Sorbitol, permease component 2
Rationale: Very important for utilization of D-sorbitol, D-mannitol. Also important for D-mannose utilization, but closely related to a P. aeruginosa system that is apparently not a mannose transporter (the substrate-binding component PA2338 does not bind mannose, see PMC6829864).
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 292 (189 residues), 45.3 bits, see alignment E=4.4e-16

Best Hits

Swiss-Prot: 36% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 97% identity to pfs:PFLU2744)

MetaCyc: 95% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U674 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PS417_12710 ABC transporter for D-Mannitol and D-Sorbitol, permease component 2 (Pseudomonas simiae WCS417)
MNTTTPKNRLANPGWFLVSPSVALLLLWMIVPLGMTLYFSLIRYNLLYPGENEFVGLENF
TYFITDSGFLPGATNTLLLVGSVLLISVVFGVLISALLEASEFLGRGLVRVLLISPFFIM
PTVGALIWKNLIFHPVSGILAAVWKFFGAEPVDWLAHYPLLSIIIIVSWQWLPFAILLLM
TAMQSLDQEQKEAARLDGAGAIAIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTTTN
GGPGYASTNLAYLIYNQALVQFDVGMASAGGLIAVVIANIAAIILVRMIGKNLTDKP