Protein Info for PS417_12705 in Pseudomonas simiae WCS417

Updated annotation (from data): ABC transporter for D-Mannitol and D-Sorbitol, permease component 1
Rationale: Specific phenotypes on D-Mannitol; D-Sorbitol. Also important for D-mannose utilization, but closely related to a P. aeruginosa system that is apparently not a mannose transporter (the substrate-binding component PA2338 does not bind mannose, see PMC6829864).
Original annotation: mannitol ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 212 to 216 (5 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 263 (173 residues), 58.9 bits, see alignment E=2.9e-20

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 100% identity to pfs:PFLU2743)

MetaCyc: 94% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ45 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PS417_12705 ABC transporter for D-Mannitol and D-Sorbitol, permease component 1 (Pseudomonas simiae WCS417)
MTLQQSRRLQSLLLGTLAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYL
HINERSNYFSYAWNSVLISFSATALCLLISVPAAYSMAFYETQRTKGTLLWMLSTKMLPP
VGVLMPIYLLAKSFGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGAT
LWQEMVRVLLPIAKGGLASTVLLSLILCWNEAFWSLNLTSSSAAPLTALIASYSSPEGLF
WAKLSAVSTLACAPILIFGWISQKQLVRGLSFGAVK