Protein Info for GFF2491 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 245 to 261 (17 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 311 (304 residues), 105.8 bits, see alignment E=2.4e-34 PF00083: Sugar_tr" amino acids 49 to 214 (166 residues), 77.6 bits, see alignment E=9.4e-26

Best Hits

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF2491 Putative transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRAAVSGWLGTALEFMDFQLYSLGAALVFHEIFFPEQSAAMALILAMGTYGAGYIARIIG
AFVFGKMGDRIGRKKVLFITITMMGICTTLIGVLPTYAQIGIFAPVLLVTLRIIQGLGAG
AEISGAGTMLAEYAPKGKRGIISSLVAMGTNCGTLSATAIWAVMFFALEREQLIAWGWRI
PFLASVVVMIFAIWLRMNLKESPVFEKVSEGEKSPALTPASENTLGAMFTSKSFWLATGL
RFGQAGNSGLIQTFLAGYLVQTLLFNKSIPTDALMISSVIGFITIPLLGWLSDKYGRRLP
YIILNISAIILA