Protein Info for GFF2489 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details PF01127: Sdh_cyt" amino acids 14 to 123 (110 residues), 62.5 bits, see alignment E=2.1e-21 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 28 to 132 (105 residues), 96.2 bits, see alignment E=6.3e-32

Best Hits

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 82% identity to xau:Xaut_1966)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>GFF2489 hypothetical protein (Xanthobacter sp. DMC5)
MSTPHSGPAPARATMRTPLGRVRGLGAAKSGTEHFFTQRLTGAANLLLSIAFIIIVISVA
GQSYAAARATLGHPLVAVIILLTLLSVTTHMRIGMQVVIEDYVHTEGLKVLLIVANTFFS
IAVALAGAFAVLKISLGG