Protein Info for GFF2484 in Xanthobacter sp. DMC5

Annotation: lipid II flippase MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 14 to 30 (17 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 40 to 293 (254 residues), 52.9 bits, see alignment E=3.9e-18 PF01554: MatE" amino acids 236 to 385 (150 residues), 31.4 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 66% identity to xau:Xaut_1961)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF2484 lipid II flippase MurJ (Xanthobacter sp. DMC5)
MTTISLRKFRTLATTYGAYAGSMFSRGLELVGKLGLYMFGARALGLHDSGYFFLCLTWIG
LISTVARGGFDKAVLRHMAAELAVGRGQEARKALLTGSAIVVAGGTLATLITVGLAEPLA
VYLFHDPEVAHALRLSAYAILPQTLCIFVGYALVGFHRGAAGQLVQNGIWPVLTLGALFA
GANTLDSLLYALAASLLAATLIGLVMVVMDRHRFLVTPSPDAPADALPALWRTAMPLSVV
EVVQIFLNSLPVLLLAVFGQPSAVGAFSVANRISMLIWVVANSIGTVAAPSFAARHRQGQ
WDELRALNRRVRLAVALFGTPVVAAMVFFPKSILNLVAPGFEVAAPALMVMGLGQLVNCL
LPCQDFMLSMTGYGSVHRWLNIAQLVVCSALCASLIPFFGMMGAAIATAVFIAQGAIGTT
LAVRHLMPKAW