Protein Info for GFF2484 in Sphingobium sp. HT1-2

Annotation: Hemolysins and related proteins containing CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details PF01595: CNNM" amino acids 18 to 210 (193 residues), 170.4 bits, see alignment E=5e-54 PF00571: CBS" amino acids 298 to 344 (47 residues), 24.2 bits, see alignment 5.3e-09 PF03471: CorC_HlyC" amino acids 361 to 436 (76 residues), 74.8 bits, see alignment E=6.9e-25

Best Hits

Swiss-Prot: 40% identical to Y260_SYNY3: UPF0053 protein sll0260 (sll0260) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 85% identity to sch:Sphch_2833)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF2484 Hemolysins and related proteins containing CBS domains (Sphingobium sp. HT1-2)
MATIPPPAPTPFPWVDLIIILALVALNGVFAMSELAIVSARKPRLQAMEKAGKRGAKSAL
QLAADPGKFLSTVQIGITLIGIISGAYSGASLGGPTGERLAALGLSPNMAENLGFALVIG
LTTYASLIIGELVPKQFALRQPEPIAVLVATPMLYLAKLTAPVVWVLDKSSGLIFKLLGL
DRESEHHVTVEELHLIVAEASRSGIIEESERAIISGVVRLADRPVREVMTQRMDVDWIDI
NADEDTIRLRLLETPHTRLPVGRGSVEDIIGIVQARDIMTALFRGEALNIEALLRKAEVV
PDQVDAMDALEVLRKSDVPMVMVHDEYGHFEGIVTPADLLSAIAGHFASDRDVYDEPDLV
EREDGSLLVSGQMPIDQLAEKIDINLSEDRDYATVAGHVLWLLKRLPEVGDYAEDQGWRF
EIVDMDGRKIDKLLVAQL