Protein Info for PS417_12665 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 185 to 203 (19 residues), see Phobius details TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 18 to 334 (317 residues), 486.4 bits, see alignment E=4.5e-150 PF00291: PALP" amino acids 32 to 319 (288 residues), 285.6 bits, see alignment E=2.4e-89

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 80% identity to pfl:PFL_3098)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1C8 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PS417_12665 hypothetical protein (Pseudomonas simiae WCS417)
MSSCTAPHTADPGLLEHYVKKILAAPVYDLAVRTPLQAAPALSALLGNQVLLKREDLQPT
FSFKIRGAYNKLVQLTPEQRARGVVTASAGNHAQGVALAARELGIKARIVMPASTPELKV
LGVRSRGAQAVLHGASFPFALAYALQLAESSGCTFVSPFDDPDVIAGQGTVAMEILRQQQ
GPLDAIFVPVGGGGLIAGVAAYVKYLRPDVRIIGVEPEGSSCLLAALRAGERVVLPSVDG
FADGTAVAQVGAHGFEICRDWVDEVITVSNDALCSAIKLIYDDTRSITEPSGALAVAGIR
QYVATHNLRGQTLVAINSGANINFDSLRHVAERVAAQSVV