Protein Info for GFF2478 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hemin ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 81 to 102 (22 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 292 (28 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details PF01032: FecCD" amino acids 30 to 353 (324 residues), 286.6 bits, see alignment E=2.2e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 69% identity to ctt:CtCNB1_1182)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF2478 Hemin ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNAAAPAMAALRWTPRRLSGPSLLLGLGALLLLTLLWAAGQGAYSLPLSELPGVLLGAVT
TAAPGGSGAELVFFNIRLPRLVLGLAAGAGLGLAGALMQGLFRNPLADPGLIGVSSGAAL
AAGVTIVMGNLWFPELPRSLGSWTLVLMAFGGGLAVTVLIYLLSRGEGGTRVGLMLLAGI
AVNALAGAGLGLLNFLATDEQLRNLQFWLLGSLGGARWSAVALVGGITLVAGAIGLRLAR
PLNALALGEAQAVLLGVSIERVKQIAIVVTALAVGAVTATTGIIGFIGLVAPHMVRLVAG
PDHRWVLPGSALLGAVLVLLADAVARTVMQPAELPLGVLTAVVGVPFFLLLLRSAHGRRL