Protein Info for GFF2477 in Xanthobacter sp. DMC5

Annotation: Histidine biosynthesis bifunctional protein HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF12804: NTP_transf_3" amino acids 5 to 125 (121 residues), 29.2 bits, see alignment E=2.5e-10 PF00483: NTP_transferase" amino acids 6 to 229 (224 residues), 61.4 bits, see alignment E=2.5e-20 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 237 to 382 (146 residues), 112.8 bits, see alignment E=1.4e-36 TIGR01662: HAD hydrolase, family IIIA" amino acids 238 to 383 (146 residues), 98.7 bits, see alignment E=3.1e-32 PF13242: Hydrolase_like" amino acids 340 to 386 (47 residues), 35.2 bits, see alignment 2.4e-12 PF13419: HAD_2" amino acids 341 to 380 (40 residues), 24.7 bits, see alignment 5.5e-09

Best Hits

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 54% identity to mrd:Mrad2831_1224)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>GFF2477 Histidine biosynthesis bifunctional protein HisB (Xanthobacter sp. DMC5)
VTEQCVILLGGLGTRLGALTKDTPKPLLKVGDVPFVEVLIAEARRRGFRKFLLLAGYRAE
VVEHYITGTDVPGRFDCTVDISLEETPLGTGGALVNALPLLDESFLLVNGDTWFDFNWLD
LVATSRKNGAAFGMGLRLVQSPDRYETIALDGTRVAAVRPRGAGLTEALINGGVYYVRRD
VIEGLGMPSSLEGDLLPRLVAEGRVTGVAYDGFFIDIGIPETFTAAQTSVPARRRRPAVF
LDRDGVLNVDTGYVHAAENFTWIEGAREAIKLFNDLGYYVFLVTNQAGVARGYYEEEAIH
VLHAFVQAELREIGAELDDWRYCPFHPEGTVERYRGSHAWRKPEPGMILDLMANWPVDTA
HSFLIGDNPTDIAAAKAAGIAGHLFPGGDLLAFSCAILATSAAEPQS