Protein Info for PS417_12625 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 149 to 181 (33 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details PF01925: TauE" amino acids 9 to 259 (251 residues), 167.1 bits, see alignment E=2.7e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 97% identity to pfs:PFLU2728)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKL4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PS417_12625 membrane protein (Pseudomonas simiae WCS417)
MDVGNFGFVIAGLIVGFIVGMTGVGGGSLMTPILLWFGINPATAVGTDLLYAAITKSGGV
LVHSKNKNIDWAITGWLTLGSVPAVLLTLWFLASLHTDPSVMNAVIKQALGVVLLLTALA
ILFKKSLLAFAQRHAGDSYHMSPRNLNALTVVTGAVLGTMVALTSIGAGALGTVALFILY
PFLATRRLVGTEIAHAVPLTLVAGLGHASMGNMDWHLLGFLLMGSLPGIYVGSHMTGKLP
DGVLRPCLAVMLMAIGYKLAF