Protein Info for GFF2474 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 17 to 466 (450 residues), 372.3 bits, see alignment E=2.3e-115 PF13727: CoA_binding_3" amino acids 61 to 235 (175 residues), 39 bits, see alignment E=8.7e-14 PF02397: Bac_transf" amino acids 278 to 463 (186 residues), 222.6 bits, see alignment E=2.9e-70

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 82% identity to xau:Xaut_1951)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF2474 hypothetical protein (Xanthobacter sp. DMC5)
MTRWTHGLVNRLVLSCDVVMAALGAIIAHLRWEFLSWSQLAILWAFGIFTYVQVLQIGRG
YRVEHYVRPLRQIGHIGVGVVPAGAVIAICYYALIPIGQTNLWALLGWGVVTTLMLIFGR
LVIVRIGMSLVQTHEVLRRNVVAIGDLGRARDLVRRYEEEEGDTGLLSFVALFDDSHEEG
APLPPPGSDGLPVLGGMKDLLEYVKHNPVDIVVVAKSWNDPAAISAIANQMYQIAADVIV
ELDPDRFTLNYANLTRIAGEPALQVQQQPLKGSLGLLKGVEDYVVATIGLLLTAPILIGA
AIAIKLDSPGPILFRQPRVGLNNRVFQCYKLRTMRVDPTDDGSKGTSKNDPRITKVGNFL
RSTSIDELPQLINVLRGEMSVVGPRPHVPNMKVATNVRYEAISQYVARYRMKPGITGWAQ
INGMRGGINTLEKAERGVELDLFYIEHWSIWFDIRIMLLTVTKGMAGPSVF