Protein Info for GFF2471 in Xanthobacter sp. DMC5

Annotation: NAD(P) transhydrogenase subunit alpha part 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF05222: AlaDh_PNT_N" amino acids 5 to 139 (135 residues), 141 bits, see alignment E=2.9e-45 PF01262: AlaDh_PNT_C" amino acids 143 to 371 (229 residues), 223.5 bits, see alignment E=2.2e-70

Best Hits

Swiss-Prot: 58% identical to PNTAA_RHORU: NAD(P) transhydrogenase subunit alpha part 1 (pntAA) from Rhodospirillum rubrum

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 90% identity to xau:Xaut_1948)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF2471 NAD(P) transhydrogenase subunit alpha part 1 (Xanthobacter sp. DMC5)
MKIAVPAEIDLGEPRVGATPDTVKRLVALGASVAVESGAGVKSGILDSDFVAAGATIAPS
AWDALNGAEVVLKVRRPTEAELSSYKPGALVLAIMDPYGNDAALAAMANAGIASFAMELM
PRITRAQVMDVLSSQANLAGYRAVIDAAAEFNRALPQMMTAAGTVPAARVFVMGAGVAGL
QAIATARRLGAIVTATDVRPAAKEQVASLGAKFVAVEDEEFKQAETAAGYAKPMSAEYQA
KQAALVAEHIKKQDIVITTALIPGRPAPRLVTAEMVASMKPGSVLIDLAVERGGNVAGAV
AGQVVEVNGVKIVGHLNVPGRIAASASPLYAKNLFNFFETMVDKASKALAVKWDDELVKA
TLLTRDGAVVHPNFAPKNPAATSEGAA