Protein Info for GFF247 in Xanthobacter sp. DMC5

Annotation: Acetoin dehydrogenase operon transcriptional activator AcoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF01590: GAF" amino acids 64 to 200 (137 residues), 56.3 bits, see alignment E=1.3e-18 PF00158: Sigma54_activat" amino acids 331 to 497 (167 residues), 201.9 bits, see alignment E=1.5e-63 PF14532: Sigma54_activ_2" amino acids 332 to 502 (171 residues), 70.5 bits, see alignment E=4.5e-23 PF02954: HTH_8" amino acids 590 to 629 (40 residues), 42.2 bits, see alignment 1.4e-14

Best Hits

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_3508)

Predicted SEED Role

"Transcriptional activator of acetoin/glycerol metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>GFF247 Acetoin dehydrogenase operon transcriptional activator AcoR (Xanthobacter sp. DMC5)
VPHREIARAWEAFHQDGAASAVIRPAVMASWQRSRLHLIAADRAAAPLVSEAELFRRRHQ
NNRLVTAARPAMEEARHLLSDAHSMLILSDPDGTILEAEGDARALDTGQEVKLQQGGLWC
EAEIGTNAIGTALACGRPVQIHAAEHFCAPVQRWTCAAAPVRHPLDREIIGAVDISGSTD
TFNPQNLAHAVALAHQIEAVLGRRMEMEHEQVLRHFLSKRSLWLTEEILAFGRSGALIYS
TDRALKEAARRSDRLISDGRLTALKDVTPDAWAARIAQLLPGASVEIVREEGEEIGGVVV
LHAARRPKPAPRDTSQRDPGRELEPLAFDAIIGESAIMQEVKAKARRMAESGLPILLEGE
TGVGKEVFARAIHGARAPAGPFVPLNCGGLPRDLIASELFGYEKGAFTGADTSGKQGKVE
AADGGLLCLDEIGEMPLELQSYLLRVLEDGVVYRVGGHTGRRVDLRLVSMTNRDLTGEVA
AGRFRKDLFYRIAALRLRIPPLRERGEDVLLLLDHIGRSAAARAGLPAPRFTEAARAALA
AYSWPGNVRELRNVVEMLIAMGSADAPIDGSDLPPEIATAAAAAPAATDLRTVEEAAIRA
AVEACGGNLTRAARRLGIARSTLYMRLAALERDA