Protein Info for GFF2467 in Sphingobium sp. HT1-2

Annotation: Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) / YjbR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00639: phosphoribosylglycinamide formyltransferase" amino acids 4 to 190 (187 residues), 187.9 bits, see alignment E=7.1e-60 PF00551: Formyl_trans_N" amino acids 5 to 183 (179 residues), 167.3 bits, see alignment E=3.2e-53 PF04237: YjbR" amino acids 205 to 299 (95 residues), 47.3 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 84% identity to sch:Sphch_2818)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF2467 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) / YjbR family protein (Sphingobium sp. HT1-2)
MTKAKIGVLISGRGSNMAALLYAAKAADCPYEIVLVAANDPDAPGLALAAAEGIATFGQS
HKGLKRAEFDAVIDAQLRAAGVQYVALAGYMRLLSPKFVSGWEDRMLNIHPSLLPKYKGL
DTHQRAIDAGDSHAGCSVHIVTAELDDGPVLGQTPVAILPGDTADSLAGRILIAEHQLYS
RTLADFVTRERQPDWLLNKVREAALALPQADEIVSHGMPCFGIVKGKKFAYFTRDHHGDG
IIAVLVKTTAPEEQATLIEADPDRYYRPAYFGNDWVGIRLDLGDTDWEHIADRLHASWRQ
IAPKKLLGLMDIADQF