Protein Info for GFF2467 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-dehydropantoate 2-reductase (EC 1.1.1.169)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00745: 2-dehydropantoate 2-reductase" amino acids 2 to 305 (304 residues), 264.9 bits, see alignment E=4.7e-83 PF03446: NAD_binding_2" amino acids 2 to 103 (102 residues), 21.3 bits, see alignment E=3.6e-08 PF02558: ApbA" amino acids 3 to 150 (148 residues), 148.5 bits, see alignment E=1.7e-47 PF08546: ApbA_C" amino acids 177 to 303 (127 residues), 114.3 bits, see alignment E=7.2e-37

Best Hits

Swiss-Prot: 41% identical to PANE_STRP3: Putative 2-dehydropantoate 2-reductase (apbA) from Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 98% identity to spt:SPA0292)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF2467 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKIAIAGAGAMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAM
LADESQGEFELVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKI
YAGVTLWSSELEGAGHIMATGTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLL
SIWKKAAFNSVMNTYCALLDCNVGGFGQRPGALDLAQAVVDEFVLVAASQNIPLTEQMVM
NTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIARIGAQNNIAVPVNKLLTQLIH
AKEAQ