Protein Info for GFF2466 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF06629: MipA" amino acids 45 to 263 (219 residues), 164.6 bits, see alignment E=2e-52

Best Hits

Swiss-Prot: 44% identical to Y351_CAUVC: Putative outer membrane protein CC_0351 (CC_0351) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07274, outer membrane protein (inferred from 48% identity to cak:Caul_0410)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF2466 hypothetical protein (Sphingobium sp. HT1-2)
MKSTMVRSSIALLAMGAAAQVAVKAQDLSSSRQPVGQPSKDRIVIGLGAAVTPVYQGADD
YRVLPLPAIDIVEGRFFANFRNGVGLNLVDDRALTIGAGVTPMPGYRRRDVPTGVDRLSW
GVGGRIFANLTGGGVVATLGATQGITGSTGGFVADASLSYPIILNPKVIITPSIATSFAD
GKHMDGYFGVNAREAAASGLDQYRGKAGFKDVSALLNIVYRLDSRWSLTGSVGATSLLGR
VKDSPLVEHATRPNGFLALAYRF