Protein Info for GFF2465 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details PF03741: TerC" amino acids 19 to 209 (191 residues), 159 bits, see alignment E=5.3e-51

Best Hits

Swiss-Prot: 48% identical to Y056_HAEIN: UPF0053 protein HI_0056 (HI_0056) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 90% identity to xau:Xaut_1942)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF2465 hypothetical protein (Xanthobacter sp. DMC5)
MDYLLQLAADPAAWVALVTLVAMEVVLGIDNLIFISILTNKLPEQYRSKARRIGISLALI
MRLALLGTIAIIVRLTAPIFEVFGHAFSWRDLILIAGGLFLVWKATTEIHHTVDPRTHAE
DVKDSKVTIGFTAAIVQILLLDIVFSIDSIITAVGMTEHIPIMVIAVIAAVTCMLLAADP
LARFIEANPTVVMLALGFLIMIGMTLIAEGFGAHVPKGYVYAAMGFSTAIEGLNMMVRRR
RAAGAGH