Protein Info for GFF2463 in Xanthobacter sp. DMC5

Annotation: Gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 380 to 391 (12 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details PF01946: Thi4" amino acids 39 to 94 (56 residues), 32.4 bits, see alignment 2e-11 PF01494: FAD_binding_3" amino acids 47 to 82 (36 residues), 24.5 bits, see alignment 5.4e-09 PF00890: FAD_binding_2" amino acids 48 to 90 (43 residues), 26.9 bits, see alignment 1e-09 PF01266: DAO" amino acids 48 to 399 (352 residues), 228.8 bits, see alignment E=5.1e-71 PF13450: NAD_binding_8" amino acids 51 to 83 (33 residues), 24.3 bits, see alignment (E = 1.1e-08)

Best Hits

Swiss-Prot: 42% identical to ORDL_RHIME: Probable oxidoreductase OrdL (ordL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 77% identity to xau:Xaut_1940)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF2463 Gamma-glutamylputrescine oxidoreductase (Xanthobacter sp. DMC5)
VPNEKKKEHAMHRVAAPLNPAGHARSWYTATATAFPAFSPLKGAVRADVCVIGAGYTGLS
AALHLAEAGFKVVVLEAARVGSGASGRNGGQLHSGQRRGQDFLEKAVGREDAHKLWNLAE
EGKALVRSLIARHDIPCDLREGLILADHKARYVPDSYDYARTLAVDYGYDALQPLTRDEI
RALVGTSAYYGGLLDKGAGHLHPLNFALGLGSAAVAAGVEIHEGTRAIKVTDEAGVTVTT
DGGGSVVADFLLECGNGLMDGLDRRVDAHVMPICNYIAATEPLGDQAQEIIANGAAVADS
RFVINYFRLSADGRLLFGGGESYRRGLRPDVADFVRPFMLRIFPQLGEARIDYAWGGVLA
ITMTRMPFVRRLSPHVLVSAGYSGQGVALAPLFGKILGEAVQGQLSRFDLLGRLPVPPFP
GGTLLRTPLMMAGLSYYALRDRL