Protein Info for GFF2460 in Sphingobium sp. HT1-2

Annotation: Inner membrane protein YghQ, probably involved in polysaccharide biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 179 to 210 (32 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 18 to 287 (270 residues), 39.2 bits, see alignment E=5.6e-14 PF13440: Polysacc_synt_3" amino acids 42 to 352 (311 residues), 28.3 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 83% identity to sjp:SJA_C1-24420)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF2460 Inner membrane protein YghQ, probably involved in polysaccharide biosynthesis (Sphingobium sp. HT1-2)
VKLKRAKGSSAQDGFARILANTGWLLGGKGVGAVLSLAYLAIVTRTLGVADFGRFALVLS
AANVIKTLVSFDSWQIVVRYGQPHLADGNGNALNRVLRFCILIDLASAVAGGLIAAIIIL
AFGNQLQLGPGMGLQAWLFCMVMMITIRSSPTGILRLFDRFDSAAVAETMIPVGRMIGAG
LALALMPGITGFLIAWGAAELLCAAAYWYLALREGKGRLGSWTAGRALDARHENPGIVGF
LTATNLQTSLSAMGQQVAVLVVGLFVGPVGAGLYRLANQLAQSLTKISSLLSRSIFVELS
RTQSSHGVDALRSLFRRTNRLALIAGAIIIALILTIGHPLLGLIAGKEFLPAYPLLMLLG
VSACIDLVGVSYRPLLMATDRAGLSLRITFASTLLLLGMQAVLLPMNGTIGAAIANIVAS
IAGFLMMGLATRHALALRDPLPPETGAN