Protein Info for GFF2458 in Variovorax sp. SCN45

Annotation: CzcABC family efflux RND transporter, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 60 to 371 (312 residues), 195.9 bits, see alignment E=4.1e-62 PF16576: HlyD_D23" amino acids 69 to 302 (234 residues), 146.4 bits, see alignment E=1.6e-46 PF13533: Biotin_lipoyl_2" amino acids 87 to 123 (37 residues), 28.2 bits, see alignment 2.6e-10 PF13437: HlyD_3" amino acids 197 to 299 (103 residues), 64.9 bits, see alignment E=2.1e-21

Best Hits

KEGG orthology group: None (inferred from 60% identity to dia:Dtpsy_3518)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>GFF2458 CzcABC family efflux RND transporter, membrane fusion protein (Variovorax sp. SCN45)
MNRTLIAALAAGFTLAGCDAGRMLASEAVAASPAPTARAVVHDGVLIAVPENSPLRASLQ
VAAVESQQVQRPISAPGSIEAAPEKLVKVTSPVTGRIVKLQRALGDSVKAGDPLFTLDSA
DLSSAFGDATKAEATLRQAQRDFARQKLLFEADITARKDYEAAELAFGAATSDAQVTKNR
LAQLGAGTGGGSHRDYVLRSPISGRVIEMTGAQGGYWNDINAPVMTVADLSTVFLTASVS
EKDIAALRVGQKARIDLSAYPDQAFDGTVKYIGEVLDADTRTVKVRVAVDNRQGRFRPGM
FAKVVFSGEAHPALTVPASALVQSGLYTKVFVEKGPFAFEARKVAVGPVIGDRIEILSGL
QAGERIAVKEGVLLND