Protein Info for GFF2455 in Xanthobacter sp. DMC5

Annotation: Phenylalanine--tRNA ligase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF02912: Phe_tRNA-synt_N" amino acids 29 to 96 (68 residues), 76.3 bits, see alignment E=1.5e-25 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 48 to 353 (306 residues), 337 bits, see alignment E=6e-105 PF01409: tRNA-synt_2d" amino acids 101 to 353 (253 residues), 344.7 bits, see alignment E=3e-107

Best Hits

Swiss-Prot: 77% identical to SYFA_METNO: Phenylalanine--tRNA ligase alpha subunit (pheS) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 92% identity to xau:Xaut_1931)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF2455 Phenylalanine--tRNA ligase alpha subunit (Xanthobacter sp. DMC5)
MSATPSATDPSALEDLQESLSSAILRAQDEAGLEEVRIAALGKKGSVSELLKSLGGMSPD
ERKVMGPAINGLRDAVQGLLSHRRAALKSAALEARLATERVDVTLPVREAAAETGRVHPI
AQVTEELVAIFADMGFSVAEGPDIEDDFHNFTALNFPAGHPAREMHDTFFLPPGADGERK
VLRTHTSPVQVRTMQAKKPPIRVICPGRTYRCDSDQTHTPMFHQVEGLVIDKGAHLGHLK
WVLEEFCKSFFEVEGVKMRFRPSFFPFTEPSMEVDIQCDRSRPGEIRFGEGSDWLEILGC
GMVHPNVLRNCGIDPDEYQGFAWGMGIDRIAMLKYGMSDLRAFFEADVRWLSHYGFRPLD
FPTLAGGLSA