Protein Info for GFF2451 in Xanthobacter sp. DMC5

Annotation: Membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details amino acids 514 to 534 (21 residues), see Phobius details amino acids 554 to 575 (22 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 4 to 384 (381 residues), 311.5 bits, see alignment E=1.2e-96 PF14849: YidC_periplas" amino acids 95 to 374 (280 residues), 278.9 bits, see alignment E=7.4e-87 PF02096: 60KD_IMP" amino acids 378 to 591 (214 residues), 254.7 bits, see alignment E=5.6e-80 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 385 to 589 (205 residues), 227.7 bits, see alignment E=1.2e-71

Best Hits

Swiss-Prot: 61% identical to YIDC_BRADU: Membrane protein insertase YidC (yidC) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 83% identity to xau:Xaut_1921)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>GFF2451 Membrane protein insertase YidC (Xanthobacter sp. DMC5)
MSDNRNMFIAIGLSMVILIGWQFFFGIPQAEKQRQAAEQQRIEQTAQQQAQSGATPTPGA
APGTTPAGLPQAGAPGTPGGRALTRAEAIAASPRAPIATQRLSGSISLRGARADDLLLTE
YHETVDPKSPNIVLLSPSGGPNPFYAEFGWTSAAGAGVAVPGPDTLWTVQPGATLTEKTP
LVLTWDNGQGLTFRRTFTIDDHYMFAVKDEVENKGAAAATLYPYALVSRHGVPHVAGFYI
LHEGLIGVLGDNGLQEVTYAKMDKEKPLTFSATGGWLGITDKYWAATVIPDQSVKVDAKF
SSAMINGQQTFQTDYLAQPLTVEPGSKITSSGQLFAGAKVVQVVDGYAETYKIDRFDRLI
DWGWFYFITKPLFLVIDWIYRVVGNFGVAILVVTVLLKGIFFPLANKSYASMAKMKAVQP
ELTSIRERYADDKVKQQQAMMELYKKEKINPVAGCLPILIQIPVFFALYKVLFVTIEMRH
APFFGWIRDLSAPDPTTVFNLFGLIPWDPGSVPVIGSYLLLGAWPLIMGVTMWVQMKLNP
APPDPTQQMIFNWMPIIFTFMLAHFAAGLVIYWAWNNTLSVTQQAVIMRRNGVKIELWDN
IKGALGLGKKQAAKG