Protein Info for GFF2450 in Sphingobium sp. HT1-2

Annotation: Malate dehydrogenase (EC 1.1.1.37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01763: malate dehydrogenase, NAD-dependent
  • amino acids 3 to 310 (308 residues), 431.2 bits, E=1e-133
• PF00056: Ldh_1_N
  • amino acids 5 to 143 (139 residues), 138 bits, E=2.4e-44
• PF02866: Ldh_1_C
  • amino acids 148 to 310 (163 residues), 119.8 bits, E=1.4e-38

Best Hits

Swiss-Prot: 88% identical to MDH_SPHWW: Malate dehydrogenase (mdh) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 92% identity to sch:Sphch_1354)

MetaCyc: 84% identical to acyl-CoA reductase (NADH) (Botryococcus braunii BOT88-2)
1.2.1.-

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• mixed acid fermentation (13/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• alkane biosynthesis II (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• methylaspartate cycle (13/19 steps found)
• wax esters biosynthesis II (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.37

Protein Sequence (320 amino acids)

>GFF2450 Malate dehydrogenase (EC 1.1.1.37) (Sphingobium sp. HT1-2)
MARKKIALIGAGNIGGTLAHLAALKGLGDIVLFDVVEGVPQGKALDLSQCASVEGFDAKI
TGSNDYADIAGADVIIVTAGVARKPGMSRDDLLGINLKVMKAVGEGIAANAPDAFVICIT
NPLDAMVWALREFSGLPANKVVGMAGVLDSSRFNHFLAEEFNVSAKDVTSFVLGGHGDTM
VPVIEYSTVAGIPVPDLIKQGRSTQERIDAIVKRTRSGGGEIVALLKTGSAFYAPATSAI
AMAEAYLGDKKRLLPCAANLTGQYGVDNLYVGVPVIIGKDGVEQVIEIELNDEAKANLQV
SVDAVKELLEACKGIDPSLA