Protein Info for GFF2446 in Xanthobacter sp. DMC5

Annotation: Protein CbbX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02880: CbbX protein" amino acids 23 to 303 (281 residues), 497 bits, see alignment E=7.6e-154 PF00004: AAA" amino acids 81 to 213 (133 residues), 62.8 bits, see alignment E=1.2e-20 PF17866: AAA_lid_6" amino acids 217 to 299 (83 residues), 69.3 bits, see alignment E=6.9e-23

Best Hits

Swiss-Prot: 98% identical to CFXQ_XANFL: Protein CfxQ (cfxQ) from Xanthobacter flavus

KEGG orthology group: None (inferred from 92% identity to xau:Xaut_1916)

Predicted SEED Role

"probable RuBisCo-expression protein CbbX" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF2446 Protein CbbX (Xanthobacter sp. DMC5)
MLDVATSAPSAALPAEAAEGMLDLGALFTESEVPEFLAELDEGLIGLKPVKRRIREIAAH
LVIGRAREKLGLTSGAPTLHMAFTGNPGTGKTTVALKMAQILHRLGYVRRGHLVSVTRDD
LVGQYIGHTAPKTKEILKKAMGGVLFIDEAYYLYRPENERDYGQEAIEILLQVMENQRDD
LVVILAGYKDRMDRFFESNPGFRSRIAHHIDFPDYEDAELVEIAKTMAADADYAFSPEAE
VAIEEYVAKRRLQPNFANARSIRNALDRMRLRQSLRLFEDGGFADRAALSTISEGDVRAS
RVFAGGIDAPNYKPQTE