Protein Info for GFF2445 in Xanthobacter sp. DMC5

Annotation: Fructose-1,6-bisphosphatase class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 45 to 205 (161 residues), 120.9 bits, E=5.2e-39
• PF18913: FBPase_C
  • amino acids 213 to 344 (132 residues), 142.1 bits, E=8.8e-46

Best Hits

Swiss-Prot: 99% identical to F16PA_XANFL: Fructose-1,6-bisphosphatase class 1 (fbp) from Xanthobacter flavus

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 81% identity to xau:Xaut_1915)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• Calvin-Benson-Bassham cycle (12/13 steps found)
• gluconeogenesis I (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• oxygenic photosynthesis (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycolysis II (from fructose 6-phosphate) (8/11 steps found)
• glycolysis I (from glucose 6-phosphate) (9/13 steps found)
• gluconeogenesis III (8/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• superpathway of hexitol degradation (bacteria) (9/18 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Protein Sequence (364 amino acids)

>GFF2445 Fructose-1,6-bisphosphatase class 1 (Xanthobacter sp. DMC5)
MLEPNADHRAAVAQAAGVAASRITLTVMLDEWAGADARRRAVADTVCALATGCASLAAAI
AEGPLAGDLARTLSSGEAGEGQKALDVISNDIVIGALKAAPVAAVASEENDAPVLLDPTA
PLLVAIDPLDGSSNIDTDISVGTIFAVFPRPEGADASEPSAFLQNGRDMLAAGYVVYGPH
TAMMLTLGAGTWHFALDRAGLFRLVDAEVKVKEGAAEFAINMSNYHHWDVPVRDYVDDCL
AGKKGPRERDFNMRWVASMVADAHRIFQRGGIYLYPGDGRKGYTHGRLRLLYEAFPVAFL
MEQASGSATDGRGAILDLTAEALHQRVPFIFGSRDEVARVSRYHLEPNGHGERSPLFARR
GLFI