Protein Info for GFF2442 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Arabinose 5-phosphate isomerase (EC 5.3.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF01380: SIS" amino acids 49 to 177 (129 residues), 108.9 bits, see alignment E=1.6e-35 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 50 to 322 (273 residues), 364.3 bits, see alignment E=2.1e-113 PF00571: CBS" amino acids 206 to 263 (58 residues), 32.1 bits, see alignment E=1.2e-11 amino acids 276 to 329 (54 residues), 35.9 bits, see alignment 8e-13

Best Hits

Swiss-Prot: 57% identical to KDSD_SHIFL: Arabinose 5-phosphate isomerase KdsD (kdsD) from Shigella flexneri

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 73% identity to vpe:Varpa_6015)

MetaCyc: 57% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF2442 Arabinose 5-phosphate isomerase (EC 5.3.1.13) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTLPSSFDPARALALAQETLSIEAQAVTAVAQRLDASFAQAIEQVLGIAGRVVVMGMGKS
GHIGRKIAATLASTGTPAMFVHPAEASHGDLGMITSADVVLGISNSGESEELTAILPLIK
RMGVPLLAITGRPDSTLGRHADVVLDASVDKEACPHNLAPTASTTAQLALGDALAVALLD
ARGFKADDFARSHPGGALGRKLLTHVSDVMRTGVEAPRVSPDAGLMDLMREISAKGLGMT
AVVDADERVVGIFTDGDLRRLIEKTGSGADLRTLVARDVMHAQPRTVRPEALAVEAAGLM
EANRITSVLVVDGAGRLQGALNSNDLMRAKVI