Protein Info for GFF2441 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutathione-regulated potassium-efflux system protein KefB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 223 to 239 (17 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 8 to 378 (371 residues), 206 bits, see alignment E=1.3e-64 PF02254: TrkA_N" amino acids 416 to 529 (114 residues), 85.7 bits, see alignment E=4.6e-28 PF02080: TrkA_C" amino acids 592 to 658 (67 residues), 38.2 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 74% identity to pna:Pnap_4109)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (661 amino acids)

>GFF2441 Glutathione-regulated potassium-efflux system protein KefB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNSLDLALLYLLAAVLAVVVCRTLRLPAMLGYLVVGVVIGPNALALAQNSSGVRYLAEFG
VVFLMFVIGLEFSLSKLRAMKRHVFGLGLSQVVLTVLLTTVGSLLLTVLLPTWWNVSWQT
ALALGGVMAMSSTAIVIKMVAERLELESEHGKRVLGILLFQDLAVVPLLVIIPALASEPE
ELLRALGWASLKAVLLLGLLLTGGQKLMRWWLTLVARRKSDELFMLNLLLITLGLAWMTE
HAGLSLALGAFVAGMLISETEFKHQVETDIRPFHDVLLGLFFITIGMMLDWRLVLDRWPL
VLLLLSVSMAFKLALITGVTRAFGAPMGVALRTGLYLAQAGEFGLVLLALSGQNNLVPPQ
LFNPILASMVISMLATPVAILYANSIVTRLVGSDWLMQSVQMTSIARKAINADKHVIICG
YGRCGQNLARLLEAERIPYMALDLDPDRVRQAAAAGHSVVFGDAARLQALMAAGLHRASA
VVVTYLDTHSALKVLHHAHEQASHVPVVVRTVDDVDLEKLRAAGATEVVPEAIEASLMLA
SHALALVGVPMRRVIRVVQDQRDARYNLLRGYFHGADDDGADEIDHERLNTVTLPAGGRN
VGKTLGSLALHAVGVRVVSLRRASGKPQALSDETVFEGGDTVVISGKAPALALAEEKLLS
G