Protein Info for GFF2440 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic sulfite reductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02910: sulfite reductase, subunit A
  • amino acids 1 to 342 (342 residues), 603.7 bits, E=4.9e-186
• PF17179: Fer4_22
  • amino acids 229 to 326 (98 residues), 105.7 bits, E=3.8e-34

Best Hits

Swiss-Prot: 100% identical to ASRA_SALTY: Anaerobic sulfite reductase subunit A (asrA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to stm:STM2548)

MetaCyc: 100% identical to dissimilatory sulfite reductase alpha subunit (Salmonella enterica enterica serovar Typhimurium)
1.8.1.g [EC: 1.8.1.g]

Predicted SEED Role

"Anaerobic sulfite reductase subunit A" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

• superpathway of tetrathionate reduction (Salmonella typhimurium) (3/4 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (2/5 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (2/6 steps found)
• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.g

Protein Sequence (347 amino acids)

>GFF2440 Anaerobic sulfite reductase subunit A (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRDLIWHEKSHM
SPNTIIAPITETLFYFDKDTIQIAETDTSPIIIFARACDINAMSRLDYMYLSNGNNSDYS
YQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMRFSDEGALVSIRDPFIEAAIQ
GLGQEADYTPSFVSENRETVVTPDSVCHDPQKIRDILTHHPLWDAYDSRCISCGRCTTGC
PTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKPGERLRYRALHKVN
DYKARNGIEHMCVGCGRCDDRCPQYIKFSLIINKMTAAVRQALAEEA