Protein Info for PS417_12435 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details PF00884: Sulfatase" amino acids 239 to 526 (288 residues), 188.7 bits, see alignment E=8.1e-60

Best Hits

Swiss-Prot: 55% identical to CPTA_SALTY: Phosphoethanolamine transferase CptA (cptA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2689)

Predicted SEED Role

"UPF0141 membrane protein YijP possibly required for phosphoethanolamine modification of lipopolysaccharide" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH96 at UniProt or InterPro

Protein Sequence (583 amino acids)

>PS417_12435 hypothetical protein (Pseudomonas simiae WCS417)
MAMFKRSTTSAKGFDWAGLGWLFLFFWYFSGITQLLIQLTGTSGFSGFRQAFFMSALWLA
PMLLFPRRTRLLAALIGVVLWACSMASLGYFFIYQQEFSQSVIFIMFESNISEAGEYATQ
YFAWWIVLAFIAHTAFAVFLWTRLRPVYLPRGQSMLAAAAIVLAVVGYPLVKQIATSDNM
EQAIDRFETRIEPAVPWQMIVAYRRYTEQLDNMQGMLTSASQIPPLKNLKDSMAGQPSTL
VLVIGESTNRQRMSLYGYPRNTTPELDKLRDQLAVFDNVITPRPYTIEALQQVLTFADEE
NPDLYLKTPSIVSVMKQAGYKTYWITNQQTMTKRNTMLTTFSEQADEQVYLNNNRNQNAR
QYDGDVLAPFSKALADPAERKFIVVHLLGTHMSYQYRYPPTFDKFTDRQGVPEGVSDAQL
PTYNSYDNAVLYNDFVVSSLIKDYAKTDPNGFLLYLSDHGEDVFDSAGHTTLGRNEGKPT
APMYTIPFMAYASPKWRESHDWSFAGDLQRPYSSSQLIHTWADLAGLSFDEWDRSKSLVS
DSFTPRPLMIGNPYERQQKGLIDFSLIKPKKRTTDVVLQEPLQ