Protein Info for GFF2436 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inner membrane protein translocase component YidC, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 439 to 462 (24 residues), see Phobius details amino acids 485 to 502 (18 residues), see Phobius details amino acids 514 to 538 (25 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 5 to 372 (368 residues), 339.4 bits, see alignment E=3.6e-105 PF14849: YidC_periplas" amino acids 86 to 364 (279 residues), 274.8 bits, see alignment E=1.3e-85 PF02096: 60KD_IMP" amino acids 368 to 555 (188 residues), 253.4 bits, see alignment E=1.4e-79 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 374 to 553 (180 residues), 223 bits, see alignment E=3.4e-70

Best Hits

Swiss-Prot: 54% identical to YIDC_CUPTR: Membrane protein insertase YidC (yidC) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 66% identity to ajs:Ajs_4140)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>GFF2436 Inner membrane protein translocase component YidC, long form (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNDIRRSILWVVFGLSMVLIWDKWQIHNGHKPTFFPGSAPAVTAPAASTSQPAGSTSAGV
PSSTQATAAPGVETPAAAPGAVAQRHEVTTDLFKLVFNSEGGSLIGAELLKHAEATGQSK
DKTERPFTLLAQGGEHIYVAQTGLIGGNFPTHKTPMTLVGNPTSLADGQNELQVRFESAE
VGGVKLIKTYTFTRGRYDIGVQHEVKNVGGQAVTPQLYQQLVRDGSKLSSETPFYSTFTG
PAVYTNEKKYQKIEFANIEKDKAEFVKTASDGYVAMVQHYFASAWLLGEGVARENFARKI
DNNLFAVGSITALTAIEPGQSQSQQSRLFLGPQEEKVLETIAPGLELVKDYGWLTILAKP
LYWLLEKIHGYVANWGWAIVLLVVLIKAAFYWLNASAYRSMAKMKKINPRIMEMRERLKG
NPQQMQQEMMKIYREEKVNPLGGCFPILIQIPVFIALYWVLLSSVEMRNAPWMAWITDLS
SPDPYFILPLVMAVTTLIQTALNPLPPDPLQAKLMWLMPLMFSVMFFFFPSGLVLYWITN
NVLTIAQQAVINRSMGVPLKFSIPNFKA