Protein Info for GFF2436 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Iron-sulfur cluster regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 218.7 bits, see alignment E=2e-69 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 155.2 bits, see alignment E=8.7e-50 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 130.8 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 100% identical to ISCR_SALTI: HTH-type transcriptional regulator IscR (iscR) from Salmonella typhi

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 99% identity to ses:SARI_00332)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF2436 Iron-sulfur cluster regulator IscR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG
PGGGYLLGKDAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKCLTHALWRDLSDRLTGF
LNNITLGELVNNQEVLDVSGRQHTHDAPRASGRAQDAIDVKLRA